PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr019214.6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 702aa    MW: 79488 Da    PI: 5.3546
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr019214.6genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1301.7e-40181461127
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  lp+GfrFhPt+eel+ +yL+ k +g +  +++vi+e++++++ePwdLp +  +k++++ewyf+ +   k+++ + ++rat++g+Wk tg  kev +++
  Pbr019214.6  18 LPVGFRFHPTEEELIGHYLQLKFRGMDSLVSDVIREINMCNHEPWDLPeMsVIKSDDEEWYFYNRPIYKKNSRNDTERATSEGFWKITGPVKEVRARD 115
                  79*************************9999****************95357888999**************************************** PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyr 127
                  ++++g k++L+fy+gr ++++ t Wvmhe+ 
  Pbr019214.6 116 NKTIGKKRILTFYRGRGRNAQITPWVMHEFY 146
                  *****************************96 PP

2NAM25.82.9e-0828532389127
          NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                  ++e+++++++++g k+tL+fy+  +pk++kt+Wv+he  
  Pbr019214.6 285 TEEMIQRSKAVIGKKRTLTFYRCCEPKPKKTNWVVHEHY 323
                  44555668999**************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-448166IPR003441NAC domain
PROSITE profilePS5100544.24518167IPR003441NAC domain
PfamPF023652.2E-1919146IPR003441NAC domain
PROSITE profilePS510059.964193346IPR003441NAC domain
SuperFamilySSF1019411.57E-11285346IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MASNGIPFTR AAAGGISLPV GFRFHPTEEE LIGHYLQLKF RGMDSLVSDV IREINMCNHE  60
PWDLPEMSVI KSDDEEWYFY NRPIYKKNSR NDTERATSEG FWKITGPVKE VRARDNKTIG  120
KKRILTFYRG RGRNAQITPW VMHEFYIPQI SPNANQRDFV LCHVKKNCHV KKKSGKNTDV  180
ATCDEGESSN HNSAPDFENQ PQPPHNMGVE EEHNQPPQNL DIFQWHMGSM LANAHDNNDY  240
HGMQSALEAN ERDKNSDKEF ASTLIVNPYQ NSSEEMTHTN ILNATEEMIQ RSKAVIGKKR  300
TLTFYRCCEP KPKKTNWVVH EHYLIDSEAN PKLPQKDFVI CRMKKKSDEE DTSIGEVELG  360
SCSVSNVEDH AAAVVTPGSQ DNNSFTLLSS GYIELEDVLQ ANDTNDDCNV IQSPFGDNNC  420
SYTNKNDILT CDEVEPHSFT VSDFENETPH DMCQELCAQS QKDMDSLRLH VAQESPTYVI  480
SKNNVSTRDD DEQFRNTISN SENQATDKRI SEGFESTYDA AHQYTDADAH KWVSHRNHRG  540
NICGVDFIWL CNPNKSRKPL KTSWCEAVFG ILRRQLQKAS MAENDAFAFL KGDSHGDFST  600
SSAFCEALQQ VNLIGHPTGL GFQETRDLWI QADADAKGVP GYEEFKNRIW SSTASEDKES  660
LNGSREEAKR GTQDAPGFNV KNAVLYPREA EGNMARRLYS L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-2451452138Stress-induced transcription factor NAC1
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24590.26e-35TCV-interacting protein